.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ub4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the MazE/MazF Complex. Molecular Bases of Antidote-Toxin Recognition. Mol.Cell 11 875-884 2003
    Site NYSGXRC
    PDB Id 1ub4 Target Id NYSGXRC-T1468
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8170,126777 Molecular Weight 33542.97 Da.
    Residues 305 Isoelectric Point 6.27
    Sequence vsryvpdmgdliwvdfdptkgseqaghrpavvlspfmynnktgmclcvpcttqskgypfevvlsgqerd gvaladqvksiawrargatkkgtvapeelqlikakinvligvsryvpdmgdliwvdfdptkgseqaghr pavvlspfmynnktgmclcvpcttqskgypfevvlsgqerdgvaladqvksiawrargatkkgtvapee lqlikakinvliggphmihssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepvrkepvf tlaelvnditpenlhenidwgepkdkevw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.232
    Matthews' coefficent 2.49 Rfactor 0.21
    Waters 199 Solvent Content 50.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ub4
    1. Crystal Structure of the MazE/MazF Complex:: Molecular Bases of Antidote-Toxin Recognition
    K Kamada, F Hanaoka, SK Burley - Molecular cell, 2003 - Elsevier
     
    2. An antisense RNA controls synthesis of an SOS_induced toxin evolved from an antitoxin
    M Kawano, L Aravind, G Storz - Molecular microbiology, 2007 - Wiley Online Library
     
    3. prlF and yhaV encode a new toxin-antitoxin system in Escherichia coli
    O Schmidt, VJ Schuenemann, NJ Hand - Journal of molecular , 2007 - Elsevier
     
    4. Shutdown decay of mRNA
    C Condon - Molecular microbiology, 2006 - Wiley Online Library
     
    5. The Bacillus subtilis ydcDE operon encodes an endoribonuclease of the MazF/PemK family and its inhibitor
    O Pellegrini, N Mathy, A Gogos, L Shapiro - Molecular , 2005 - Wiley Online Library
     
    6. AbrB-like transcription factors assume a swapped hairpin fold that is evolutionarily related to double-psi _ barrels
    M Coles, S Djuranovic, J Sding, T Frickey, K Koretke - Structure, 2005 - Elsevier
     
    7. Revised structure of the AbrB N-terminal domain unifies a diverse superfamily of putative DNA-binding proteins
    BG Bobay, A Andreeva, GA Mueller, J Cavanagh - FEBS letters, 2005 - Elsevier
     
    8. Mutagenesis-based definitions and probes of residue burial in proteins
    K Bajaj, P Chakrabarti - Proceedings of the , 2005 - National Acad Sciences
     
    9. Characterization of Dual Substrate Binding Sites in the Homodimeric Structure of Escherichia coli mRNA Interferase MazF
    GY Li, Y Zhang, MCY Chan, TK Mal, KP Hoeflich - Journal of molecular , 2006 - Elsevier
     
    10. Structure and function of bacterial kid-kis and related toxin-antitoxin systems
    MB Kamphuis, M Chiara Monti - Protein and Peptide , 2007 - ingentaconnect.com
     
    11. Structural and thermodynamic characterization of the Escherichia coli RelBE toxin-antitoxin system: indication for a functional role of differential stability
    I Cherny, M Overgaard, J Borch, Y Bram, K Gerdes - Biochemistry, 2007 - ACS Publications
     
    12. Toxin-antitoxin systems in bacteria and archaea
    Y Yamaguchi, JH Park, M Inouye - Annual review of genetics, 2011 - annualreviews.org
     
    13. Interactions between the toxin Kid of the bacterial parD system and the antitoxins Kis and MazE
    MB Kamphuis, MC Monti - PROTEINS: , 2007 - Wiley Online Library
     
    14. parD toxinantitoxin system of plasmid R1basic contributions, biotechnological applications and relationships with closely_related toxinantitoxin systems
    E Diago_Navarro, AM Hernandez_Arriaga - Febs , 2010 - Wiley Online Library
     
    15. Prokaryotic toxin-antitoxin systemsthe role in bacterial physiology and application in molecular biology
    M Bukowski, A Rojowska, B Wladyka - Acta Biochim Pol, 2011 - ptbioch.edu.pl
     
    16. Crystal structure of the DNA-bound VapBC2 antitoxin/toxin pair from Rickettsia felis
    MJ Mat, R Vincentelli, N Foos, D Raoult - Nucleic Acids , 2011 - Oxford Univ Press
     
    17. Structural Models of Protein-DNA Complexes Based on Interface Prediction and Docking
    S Qin, HX Zhou - Current Protein and Peptide Science, 2011 - ingentaconnect.com
     
    18. Amino-acid-dependent main-chain torsion-energy terms for protein systems
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1206.3909, 2012 - arxiv.org
     
    19. Optimizations of protein force fields
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1208.6150, 2012 - arxiv.org
     
    20. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch