.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vhy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a set of proteins resulting from a bacterial genomics project. Proteins 60 787-796 2005
    Site NYSGXRC
    PDB Id 1vhy Target Id NYSGXRC-T1471
    Molecular Characteristics
    Source Haemophilus influenzae rd
    Alias Ids TPS8173,1573272 Molecular Weight 28724.49 Da.
    Residues 257 Isoelectric Point 6.67
    Sequence mslripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkksvkveil greladkeshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvkldaermdkkiqqwqkiai aaceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggvrlligsegglsaqei aqteqqgfteillgkrvlrtetaslaaisalqicfgdlgeeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.3
    Matthews' coefficent Rfactor 0.229
    Waters 338 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vhy
    1. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    2. Structural statistical properties of knotted proteins
    W Xiang-Hong, S Yu, Z Lin-Xi - Chinese Physics B, 2009 - iopscience.iop.org
     
    3. Insights into the Catalytic Mechanism of 16S rRNA Methyltransferase RsmE (m 3 U1498) from Crystal and Solution Structures
    H Zhang, H Wan, ZQ Gao, Y Wei, WJ Wang - Journal of Molecular , 2012 - Elsevier
     
    4. The Conformational Relationship between Knotted Proteins and Corresponding mRNA Templates
    RH Hung - 2007 - etdncku.lib.ncku.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch