.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vi8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a set of proteins resulting from a bacterial genomics project. Proteins 60 787-796 2005
    Site NYSGXRC
    PDB Id 1vi8 Target Id NYSGXRC-T1470
    Related PDB Ids 1vh5 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8172,13878877 Molecular Weight 16297.81 Da.
    Residues 148 Isoelectric Point 6.83
    Sequence msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvvlaesigs vagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifdekgrlccssrlttail eggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.302
    Matthews' coefficent Rfactor 0.241
    Waters 621 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vi8
    1. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    2. Divergence of Function in the Hot Dog Fold Enzyme Superfamily: The Bacterial Thioesterase YciA
    Z Zhuang, F Song, H Zhao, L Li, J Cao, E Eisenstein - Biochemistry, 2008 - ACS Publications
     
    3. Structure and function of a Campylobacter jejuni thioesterase Cj0915, a hexameric hot dog fold enzyme
    T Yokoyama, KJ Choi, AM Bosch, HJ Yeo - Biochimica et Biophysica Acta ( , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch