.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vqv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thiamine Monophosphate Kinase (Thil) from Aquifex Aeolicus. To be Published
    Site NYSGXRC
    PDB Id 1vqv Target Id NYSGXRC-T1881
    Molecular Characteristics
    Source Aquifex aeolicus vf5
    Alias Ids TPS8254,15607070 Molecular Weight 34410.75 Da.
    Residues 306 Isoelectric Point 5.37
    Sequence mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeavgwkaisvnv sdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksekigisvflvgeter fvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkhiqkyanasmd isdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalfggedyqllfthpkerwnpf ldmteigrveegegvfvdgkkvepkgwkhf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.65 Rfree 0.26
    Matthews' coefficent 3.00 Rfactor 0.238
    Waters 116 Solvent Content 59.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1vqv
    1. Complexed structures of formylglycinamide ribonucleotide amidotransferase from Thermotoga maritima describe a novel ATP binding protein superfamily
    M Morar, R Anand, AA Hoskins, JA Stubbe - Biochemistry, 2006 - ACS Publications
     
    2. Structure of [NiFe] hydrogenase maturation protein HypE from Escherichia coli and its interaction with HypF
    ES Rangarajan, A Asinas, A Proteau - Journal of , 2008 - Am Soc Microbiol
     
    3. Structural Studies of Thiamin Monophosphate Kinase in Complex with Substrates and Products,
    KM McCulloch, C Kinsland, TP Begley, SE Ealick - Biochemistry, 2008 - ACS Publications
     
    4. Crystal structure of phosphoribosylformylglycinamidine synthase II (smPurL) from Thermotoga maritima at 2.15 resolution
    II Mathews, S Krishna - Proteins: Structure, , 2006 - Wiley Online Library
     
    5. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    6. Structure of an N-terminally truncated selenophosphate synthetase from Aquifex aeolicus
    E Matsumoto, S Sekine, R Akasaka, Y Otta - Section F: Structural , 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch