.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vqw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mechanism of action of a flavin-containing monooxygenase. Proc.Natl.Acad.Sci.Usa 103 9832-9837 2006
    Site NYSGXRC
    PDB Id 1vqw Target Id NYSGXRC-T1729
    Related PDB Ids 2gv8 2gvc 
    Molecular Characteristics
    Source Schizosaccharomyces pombe
    Alias Ids TPS8224,19112574 Molecular Weight 51095.85 Da.
    Residues 457 Isoelectric Point 6.81
    Sequence mslclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpstnpilt tepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqriyaqpllpfiklat dvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyipnikgldeyakavpgsvlhsslfr epelfvgesvlvvggassandlvrhltpvakhpiyqsllgggdiqneslqqvpeitkfdpttreiylkg gkvlsnidrviyctgylysvpfpslaklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpf ptsqaqaaflarvwsgrlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpv leeefpspywgekersirenmwsirakffgieppkeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.239
    Matthews' coefficent 3.20 Rfactor 0.226
    Waters 382 Solvent Content 61.00

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1vqw
    1. Mechanism of action of a flavin-containing monooxygenase
    S Eswaramoorthy, JB Bonanno - Proceedings of the , 2006 - National Acad Sciences
     
    2. Investigation of structure and function of a catalytically efficient variant of the human flavin-containing monooxygenase form 3
    T Borbs, J Zhang, MA Cerny, I Lik - Drug metabolism and , 2006 - ASPET
     
    3. A Flavoprotein Monooxygenase that Catalyses a BaeyerVilliger Reaction and Thioether Oxidation Using NADH as the Nicotinamide Cofactor
    CN Jensen, J Cartwright, J Ward, S Hart - , 2012 - Wiley Online Library
     
    4. Characterization of Sulfoxygenation and Structural Implications of Human Flavin-Containing Monooxygenase Isoform 2 (FMO2. 1) Variants S195L and N413K
    SK Krueger, MC Henderson, LK Siddens - Drug Metabolism and , 2009 - ASPET
     
    5. Insulin as a regulator of flavin-containing monooxygenase enzyme in streptozotocin-induced diabetic rats
    T Borbs - 2007 - phd.sote.hu
     
    6. The biochemistry of siderophore biosynthesis
    KM Meneely - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch