.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wue

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein GI:29375081, unknown member of enolase superfamily from enterococcus faecalis V583. To be Published
    Site NYSGXRC
    PDB Id 1wue Target Id NYSGXRC-T2185
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS8274,29375081 Molecular Weight 43910.17 Da.
    Residues 386 Isoelectric Point 5.94
    Sequence ghhhhhhhhhhglvprgshmniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelva feqpdyvqetlvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqqks lteffgptrrkipvgislgiqedlpqllkqvqlavekgyqrvklkirpgydvepvalirqhfpnlplmv dansaytladlpqlqrldhyqlamieqpfaaddfldhaqlqrelktricldenirslkdcqvalalgsc rsinlkiprvggihealkiaafcqendllvwlggmfesgvgralnlqfasqptfsfpgdisateryfye diitepfileqgtmtvpqglgigvtlsqtnllkysqyqkim
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.242
    Matthews' coefficent 2.31 Rfactor 0.207
    Waters 405 Solvent Content 44.76

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wue
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch