.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x77

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure determination of an FMN reductase from Pseudomonas aeruginosa PA01 using sulfur anomalous signal. ACTA CRYSTALLOGR.,SECT.D 62 383-391 2006
    Site NYSGXRC
    PDB Id 1x77 Target Id NYSGXRC-T1501
    Related PDB Ids 1rtt 
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8181,15596401 Molecular Weight 21093.71 Da.
    Residues 193 Isoelectric Point 6.04
    Sequence mslsddikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverfreq iraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtaraqyhlrqtlvfld vhplnkpevmissaqnafdaqgrllddkareliqqqlqalqlwvreggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.282
    Matthews' coefficent 2.90 Rfactor 0.219
    Waters 160 Solvent Content 54.00

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals

    Jmol

     
    Google Scholar output for 1x77
    1. Structure determination of an FMN reductase from Pseudomonas aeruginosa PA01 using sulfur anomalous signal
    R Agarwal, JB Bonanno, SK Burley - Section D: Biological , 2006 - scripts.iucr.org
     
    2. A single intersubunit salt bridge affects oligomerization and catalytic activity in a bacterial quinone reductase
    A Binter, N Staunig, I Jelesarov, K Lohner - FEBS , 2009 - Wiley Online Library
     
    3. Reaction mechanism of azoreductases suggests convergent evolution with quinone oxidoreductases
    A Ryan, CJ Wang, N Laurieri, I Westwood, E Sim - Protein & Cell, 2010 - Springer
     
    4. ArsH from the cyanobacterium Synechocystis sp. PCC 6803 is an efficient NADPH-dependent quinone reductase
    M Hervas, L Lopez-Maury, P Leon - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch