.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x8m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 1x8m Target Id NYSGXRC-T1827
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8250,16130747 Molecular Weight 31042.79 Da.
    Residues 278 Isoelectric Point 5.71
    Sequence vdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvggevgkqlgv syflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidtgtpakfyyncapahttyp tkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmgltelapgnlwntmpchtherrmevyfy fnmdddacvfhmmgqpqetrhivmhneqavispswsihsgvgtkaytfiwgmvgenqvfddmdhvavkdlr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.60 Rfree 0.28
    Matthews' coefficent 2.72 Rfactor 0.257
    Waters Solvent Content 53.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x8m
    1. Piecing together the structurefunction puzzle: Experiences in structure_based functional annotation of hypothetical proteins
    MA Adams, MDL Suits, J Zheng, Z Jia - Proteomics, 2007 - Wiley Online Library
     
    2. The crystal structure of 5_keto_4_deoxyuronate isomerase from Escherichia coli
    RL Crowther, MM Georgiadis - Proteins: Structure, Function, , 2005 - Wiley Online Library
     
    3. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    4. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch