.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x94

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of two putative phosphoheptose isomerases. Proteins 63 1092-1096 2006
    Site NYSGXRC
    PDB Id 1x94 Target Id NYSGXRC-T1485
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8176,15642228 Molecular Weight 21998.69 Da.
    Residues 203 Isoelectric Point 6.09
    Sequence mslyqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdamhfaeelt gryrenrpgypgiaisdpshlscvsndfgydyvfsryveavgakgdvlfglstsgnsgnilkaieaaka kgmktialtgkdggkmagladveirvphfgyadriqevhikiihiiiqliekemaeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.285
    Matthews' coefficent 2.40 Rfactor 0.229
    Waters 68 Solvent Content 47.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x94
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Structure and function of sedoheptulose-7-phosphate isomerase, a critical enzyme for lipopolysaccharide biosynthesis and a target for antibiotic adjuvants
    PL Taylor, KM Blakely, GP de Leon, JR Walker - Journal of Biological , 2008 - ASBMB
     
    3. N-acetylmuramic acid 6-phosphate lyases (MurNAc etherases): role in cell wall metabolism, distribution, structure, and mechanism
    T Jaeger, C Mayer - Cellular and Molecular Life Sciences, 2008 - Springer
     
    4. The Structure of Sedoheptulose-7-Phosphate Isomerase from Burkholderia pseudomallei Reveals a Zinc Binding Site at the Heart of the Active Site
    NJ Harmer - Journal of molecular biology, 2010 - Elsevier
     
    5. Crystal structures of two putative phosphoheptose isomerases
    J Seetharaman, KR Rajashankar - Proteins: Structure, , 2006 - Wiley Online Library
     
    6. Probing the active site of the sugar isomerase domain from E. coli arabinose_5_phosphate isomerase via X_ray crystallography
    LJ Gourlay, S Sommaruga, M Nardini - Protein , 2010 - Wiley Online Library
     
    7. Crystal structure of YfeU protein from Haemophilus influenzae: a predicted etherase involved in peptidoglycan recycling
    Y Kim, P Quartey, R Ng, TI Zarembinski - Journal of structural and , 2009 - Springer
     
    8. Crystallographic and NMR Studies of Aquifex Aeolicus Phosphoheptose Isomerase: Structural Insights into the Mechanism of Aldose-Ketose Isomerization.
    V Thai, G Petsko, D Kern - The role of structure and dynamics in , 2007 - books.google.com
     
    9. In silico quest for putative drug targets in Helicobacter pylori HPAG1: molecular modeling of candidate enzymes from lipopolysaccharide biosynthesis pathway
    M Sarkar, L Maganti, N Ghoshal, C Dutta - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch