.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xfj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein from Caulobacter crescentus. To be Published
    Site NYSGXRC
    PDB Id 1xfj Target Id NYSGXRC-T890
    Molecular Characteristics
    Source Caulobacter crescentus cb15
    Alias Ids TPS8148,Q9AAV3 Molecular Weight 27974.93 Da.
    Residues 261 Isoelectric Point 5.11
    Sequence mktpalptvqspllsslpgvkhafftrqggvskgiydslnvgrgsqdepadveenrariarwfgggped lnvcyqihstiaivadgswgdarpegdavvsktpgvicgamaadcapvllvdpearivaaahagwrgal dgvvqsavdrmvelgaspanitgvvgpcigpksyevgleflhrfeadcpgsgrffkpgasedkrffdlp afvldrlatagverrewvgrdtraeeewffsnrraflnndgdygrllsaitlea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.22
    Matthews' coefficent 2.00 Rfactor 0.18
    Waters 253 Solvent Content 40.00

    Ligand Information
    Ligands ACT (ACETATE) x 1;BME (BETA-MERCAPTOETHANOL) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1xfj
    1. A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation
    X Chao, TJ Muff, SY Park, S Zhang, AM Pollard - Cell, 2006 - Elsevier
     
    2. Recent insights into Pasteurella multocida toxin and other G-protein-modulating bacterial toxins
    BA Wilson, M Ho - Future microbiology, 2010 - Future Medicine
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch