.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xm5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The ybeY protein from Escherichia coli is a metalloprotein. Acta Crystallogr.,Sect.F 61 959-963 2005
    Site NYSGXRC
    PDB Id 1xm5 Target Id NYSGXRC-T842
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8147,P77385 Molecular Weight 17524.77 Da.
    Residues 155 Isoelectric Point 4.26
    Sequence msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrgkdkptnvls fpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhllgydhieddeaeemealet eimlalgyedpyiaeke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.273
    Matthews' coefficent 2.61 Rfactor 0.234
    Waters Solvent Content 51.10

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 4

    Jmol

     
    Google Scholar output for 1xm5
    1. Metalloproteomics: high-throughput structural and functional annotation of proteins in structural genomics
    W Shi, C Zhan, A Ignatov, BA Manjasetty, N Marinkovic - Structure, 2005 - Elsevier
     
    2. Prediction of transition metal_binding sites from apo protein structures
    M Babor, S Gerzon, B Raveh - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. A high-throughput approach to protein structure analysis
    BA Manjasetty, W Shi, C Zhan, A Fiser, MR Chance - Genetic Engineering, 2007 - Springer
     
    4. The ybeY protein from Escherichia coli is a metalloprotein
    C Zhan, EV Fedorov, W Shi, UA Ramagopal - Section F: Structural , 2005 - scripts.iucr.org
     
    5. A highly conserved protein of unknown function in Sinorhizobium meliloti affects sRNA regulation similar to Hfq
    SP Pandey, BK Minesinger, J Kumar - Nucleic Acids , 2011 - Oxford Univ Press
     
    6. Structural Bioinformatics of Neisseria meningitidis LD-Carboxypeptidase: Implications for Substrate Binding and Specificity
    Y Rashid, M Kamran Azim - The Protein Journal, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch