.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xrh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Ureidoglycolate Dehydrogenase from Escherichia Coli. To be Published
    Site NYSGXRC
    PDB Id 1xrh Target Id NYSGXRC-T1456
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8166,2497861 Molecular Weight 37833.92 Da.
    Residues 348 Isoelectric Point 5.77
    Sequence kisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskggtnrepefrle etgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsgaisyfvqqaaragfigismcq sdpmvvpfggaeiyygtnplafaapgegdeiltfdmattvqawgkvldarsrnmsipdtwavdkngvpt tdpfavhallpaagpkgyglmmmidvlsgvllglpfgrqvssmyddlhagrnlgqlhivinpnffssse lfrqhlsqtmrelnaitpapgfnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.25 Rfree 0.25
    Matthews' coefficent 2.38 Rfactor 0.192
    Waters 644 Solvent Content 47.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xrh
    1. Crystal structure of ureidoglycolate hydrolase (AllA) from Escherichia coli O157: H7
    S Raymond, A Tocilj, E Ajamian, Y Li - Proteins: Structure, , 2005 - Wiley Online Library
     
    2. Crystal Structures of _1-Piperideine-2-carboxylate/_1-Pyrroline-2-carboxylate Reductase Belonging to a New Family of NAD (P) H-dependent Oxidoreductases
    M Goto, H Muramatsu, H Mihara, T Kurihara - Journal of Biological , 2005 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch