.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xwy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tatD DNase from Escherichia coli at 2.0 A resolution. To be Published
    Site NYSGXRC
    PDB Id 1xwy Target Id NYSGXRC-T2213
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8278,3123499 Molecular Weight 29551.99 Da.
    Residues 264 Isoelectric Point 5.19
    Sequence meyrmfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscwstagvhphd ssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlriaadlnmpvfmhcrdaher fmtllepwldklpgavlhcftgtreemqacvahgiyigitgwvcderrglelrellplipaekllietd apyllprdltpkpssrrnepahlphilqriahwrgedaawlaattdanvktlfgiaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.216
    Matthews' coefficent 3.20 Rfactor 0.171
    Waters 301 Solvent Content 61.20

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1xwy
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. Widespread distribution of cell defense against D-aminoacyl-tRNAs
    S Wydau, G Van der Rest, C Aubard, P Plateau - Journal of Biological , 2009 - ASBMB
     
    3. DNA nucleases
    NC HORTON - Structural Biology. Cambridge, UK: The Royal , 2008 - books.google.com
     
    4. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    5. Cartographie structurale et fonctionnelle de la liaison entre la peptidyl-ARNt hydrolase et son substrat
    G Laurent - 2010 - hal-polytechnique.archives-ouvertes
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch