.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xxl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of YcgJ protein from Bacillus subitilis at 2.1 A resolution. To be Published
    Site NYSGXRC
    PDB Id 1xxl Target Id NYSGXRC-T1761
    Related PDB Ids 2glu 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8230,16077385 Molecular Weight 26962.97 Da.
    Residues 238 Isoelectric Point 6.08
    Sequence mslglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqekgvenvrfqqg taeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdhyapedpvldefvnhlnrlrd pshvresslsewqamfsanqlayqdiqkwnlpiqydswikrggtpadrekqiithlnhasdeardtfci tlnqngqpisfclkailiqgikreghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.22423
    Matthews' coefficent 3.03 Rfactor 0.17638
    Waters 327 Solvent Content 59.11

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 1xxl
    1. Molecular phylogenetics and comparative modeling of HEN1, a methyltransferase involved in plant microRNA biogenesis
    K Tkaczuk, A Obarska, J Bujnicki - BMC evolutionary biology, 2006 - biomedcentral.com
     
    2. Bud23 methylates G1575 of 18S rRNA and is required for efficient nuclear export of pre-40S subunits
    J White, Z Li, R Sardana, JM Bujnicki - and cellular biology, 2008 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch