.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y0g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF THE ESCHERICHIA COLI YCEI PERIPLASMIC PROTEIN. To be Published
    Site NYSGXRC
    PDB Id 1y0g Target Id NYSGXRC-T792
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8134,Q9I690 Molecular Weight 20911.36 Da.
    Residues 191 Isoelectric Point 5.57
    Sequence mkksllgltfaslmfsagsavaadykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaad kvnvtinttsvdtnhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtlea kligqgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.248
    Matthews' coefficent 2.59 Rfactor 0.228
    Waters 316 Solvent Content 52.10

    Ligand Information
    Ligands 8PP (2-[(2E,6E,10E,14E,18E,22E,26E)-3,7,11,15,19,23,27,31-) x 4
    Metals

    Jmol

     
    Google Scholar output for 1y0g
    1. A high-throughput approach to protein structure analysis
    BA Manjasetty, W Shi, C Zhan, A Fiser, MR Chance - Genetic Engineering, 2007 - Springer
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Helicobacter pylori acidic stress response factor HP1286 is a YceI homolog with new binding specificity
    L Sisinni, L Cendron, G Favaro, G Zanotti - FEBS Journal, 2010 - Wiley Online Library
     
    4. Structure of a polyisoprenoid binding domain from Saccharophagus degradans implicated in plant cell wall breakdown
    F Vincent, DD Molin, RM Weiner, Y Bourne - FEBS letters, 2010 - Elsevier
     
    5. Structural characterisation, stability and antibody recognition of chimeric NHBA-GNA1030: An investigational vaccine component against Neisseria meningitidis
    A Martino, C Magagnoli, G De Conciliis, S D'Ascenzi - Vaccine, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch