.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y1l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal stracture of arsenate reductase from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 1y1l Target Id NYSGXRC-T1770
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS8237,11498957 Molecular Weight 16832.28 Da.
    Residues 152 Isoelectric Point 6.14
    Sequence mghhhhhhgghmslkvlfvcihntarsvmaealfnamakswkaesagvekaervdetvkrllaerglka kekprtvdevnlddfdlivtvceesscvvlptdkpvtrwhienpagkdegtyrrvlaeieervkklvge leggqssspleggs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.297
    Matthews' coefficent 2.36 Rfactor 0.252
    Waters Solvent Content 47.40

    Ligand Information
    Ligands
    Metals CD (CADMIUM) x 8

    Jmol

     
    Google Scholar output for 1y1l
    1. Arsenate reduction: thiol cascade chemistry with convergent evolution
    J Messens, S Silver - Journal of molecular biology, 2006 - Elsevier
     
    2. A structure-based approach for detection of thiol oxidoreductases and their catalytic redox-active cysteine residues
    SM Marino, VN Gladyshev - PLoS computational biology, 2009 - dx.plos.org
     
    3. Interplay between ion binding and catalysis in the thioredoxin-coupled arsenate reductase family
    G Roos, L Buts, K Van Belle, E Brosens - Journal of molecular , 2006 - Elsevier
     
    4. Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms
    AF Villadangos, K Van Belle, K Wahni - Molecular , 2011 - Wiley Online Library
     
    5. A novel framework for protein structure prediction
    R Bondugula - 2007 - mospace.umsystem.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch