.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y23

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a member of HIT family of proteins from bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 1y23 Target Id NYSGXRC-T2097
    Molecular Characteristics
    Source Eubacteria firmicutes low g+c gram-positive bacteria bacillaceae bacillus
    Alias Ids TPS8272,2226116 Molecular Weight 16297.62 Da.
    Residues 145 Isoelectric Point 6.11
    Sequence mhcaencifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqyfhavp kiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthaddykpedlqnisssi akrlass
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.30 Rfree 0.249
    Matthews' coefficent 2.38 Rfactor 0.213
    Waters 287 Solvent Content 47.98

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 5;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1y23
    1. Crystallization and preliminary X-ray analysis of XC1015, a histidine triad-like protein from Xanthomonas campestris
    WT Lo, KH Chin, HL Shr, FP Gao, PC Lyu - Section F: Structural , 2006 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch