.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y65

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of beta-hexosaminidase from Vibrio cholerae in complex with N-acetyl-D-glucosamine to a resolution of 1.85. To be Published
    Site NYSGXRC
    PDB Id 1y65 Target Id NYSGXRC-T1608
    Related PDB Ids 1tr9 
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8203,15640711, 60594517 Molecular Weight 37817.06 Da.
    Residues 342 Isoelectric Point 5.64
    Sequence mslgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpiligvdqeggr vqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldmgfackaignrafgedv qtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyderetiaqdmaifraqieagvldammp ahvvyphydaqpasgssywlkqvlreelgfkgivfsddlsmegaavmggpvershqalvagcdmilicn kreaavevldnlpimevpqaeallkkqqfsyselkrlerwqqasanmqrlieqfseeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.209
    Matthews' coefficent 2.36 Rfactor 0.157
    Waters 466 Solvent Content 47.57

    Ligand Information
    Ligands NAG (N-ACETYL-D-GLUCOSAMINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1y65
    1. Plant glycosyl hydrolases and biofuels: a natural marriage
    G Lopez-Casado, BR Urbanowicz - Current opinion in plant , 2008 - Elsevier
     
    2. Crystal Structure of the Polyextremophilic _-Amylase AmyB from Halothermothrix orenii: Details of a Productive EnzymeSubstrate Complex and an N
    TC Tan, BN Mijts, K Swaminathan, BKC Patel - Journal of molecular , 2008 - Elsevier
     
    3. Structural rationale for low-nanomolar binding of transition state mimics to a family GH3 _-D-glucan glucohydrolase from barley
    M Hrmova, VA Streltsov, BJ Smith, A Vasella - Biochemistry, 2005 - ACS Publications
     
    4. Enzymatic deconstruction of xylan for biofuel production
    D Dodd, IKO Cann - GCB Bioenergy, 2009 - Wiley Online Library
     
    5. Structural and Functional Analyses of [beta]-Glucosidase 3B from Thermotoga neapolitana: A Thermostable Three-Domain Representative of Glycoside Hydrolase 3
    T Pozzo, JL Pasten, EN Karlsson, DT Logan - Journal of molecular biology, 2010 - Elsevier
     
    6. Dissecting the catalytic mechanism of a plant [beta]-d-glucan glucohydrolase through structural biology using inhibitors and substrate analogues
    M Hrmova, GB Fincher - Carbohydrate research, 2007 - Elsevier
     
    7. Insight into a strategy for attenuating AmpC_mediated __lactam resistance: Structural basis for selective inhibition of the glycoside hydrolase NagZ
    MD Balcewich, KA Stubbs, Y He, TW James - Protein , 2009 - Wiley Online Library
     
    8. Structural insights into the _-xylosidase from Trichoderma reesei obtained by synchrotron small-angle X-ray scattering and circular dichroism spectroscopy
    AL Rojas, H Fischer, EV Eneiskaya - Biochemistry, 2005 - ACS Publications
     
    9. Expression, purification, crystallization and preliminary X-ray diffraction analysis of Thermotoga neapolitana-glucosidase B
    P Turner, A Pramhed, E Kanders - Section F: Structural , 2007 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch