.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y7b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of beta-xylosidase from Clostridium acetobutylicum. To be Published
    Site NYSGXRC
    PDB Id 1y7b Target Id NYSGXRC-T1998
    Related PDB Ids 1yi7 
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS8261,15896693 Molecular Weight 61243.63 Da.
    Residues 533 Isoelectric Point 5.71
    Sequence miknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtslldmkgnpnsg giwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpitlngsgfdaslfhdndgkky lvnmywdqrtynhnfygivlqeysdkekkligkakiiykgtdikytegphiyhigdyyylftaeggtty ehsetvarsknidgpyeidpeyplltswhdprnslqkcghaslvhthtdewylahlvgrplpvgnqpvl eqrgycplgretsiqriewvdnwprvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslr iplteniaslkakkgnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyynte nwstiqvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdginwsk vpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.206
    Matthews' coefficent 2.37 Rfactor 0.157
    Waters 3000 Solvent Content 48.00

    Ligand Information
    Ligands SO4 (SULFATE) x 6;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 4;PGE (TRIETHYLENE) x 1;GOL (GLYCEROL) x 14
    Metals CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 1y7b
    1. The Structure of an Inverting GH43 [beta]-Xylosidase from Geobacillus stearothermophilus with its Substrate Reveals the Role of the Three Catalytic Residues
    C Brx, A Ben-David, D Shallom-Shezifi, M Leon - Journal of molecular , 2006 - Elsevier
     
    2. Structure-function relationships of a catalytically efficient _-D-xylosidase
    DB Jordan, XL Li, CA Dunlap, TR Whitehead - Applied biochemistry , 2007 - Springer
     
    3. The Structure of an Inverting GH43 b-Xylosidase from Geobacillus stearothermophilus with its Substrate Reveals the Role of the Three Catalytic Residues
    K Niefind, G Shoham, Y Shoham, D Schomburg - J. Mol. Biol, 2006 - biotech.technion.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch