.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y7e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of aminopeptidase I (yscI) from Borrelia burgdorferi. To be Published
    Site NYSGXRC
    PDB Id 1y7e Target Id NYSGXRC-T1808
    Molecular Characteristics
    Source Borrelia burgdorferi
    Alias Ids TPS8247,15594711 Molecular Weight 51497.18 Da.
    Residues 458 Isoelectric Point 5.77
    Sequence mkkqnpwiylneeeknqilnfsesykkfiskfkterevtayaldkakklgfinaeekknlmpgdkifyt creksvafaiigknpiedgmnfivshtdsprldakpspiseeneltfiktnyyggikkyqwlstplsir gvvflkngekveinigdnendpvfvipdilphldrkiqrnkksdeivegenlkiligslpietkeknkv klatlqlikekykieeedfvsseieivpagtakdvgfdkaligaygqddkicvftslesifdleetpnk taicflvdkeeigstgstgldsryleyfvsdmifkikkseynnlhvqkalwnsksisadvcaainplfs svhdeqnapqlgygipimkytghggksmasdadaelvsyirqllnknniawqvatlgkveeggggtvak flagygirtidmgpavismhspmeitskfdlynaylaykafyre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.20 Rfree 0.258
    Matthews' coefficent 3.24 Rfactor 0.202
    Waters 64 Solvent Content 61.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1y7e
    1. An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution
    O Kirillova, M Chruszcz, IA Shumilin - Section D: Biological , 2007 - scripts.iucr.org
     
    2. Crystallization of Saccharomyces cerevisiae aminopeptidase 1, the major cargo protein of the Cvt pathway
    W Adachi, NN Suzuki, Y Fujioka, K Suzuki - Section F: Structural , 2007 - scripts.iucr.org
     
    3. Aminopeptidase I enzymatic activity
    P Schu - Methods in enzymology, 2008 - Elsevier
     
    4. The propeptide of Aminopeptidase 1 mediates aggregation and vesicle formation in the Cytoplasm-to-vacuole targeting pathway
    MM Quinones, PE Stromhaug - Journal of Biological Chemistry, 2011 - ASBMB
     
    5. A unique way to form a vesicle: aminopeptidase 1 aggregation and its binding to receptor ATG19 for recruitment of autophagic proteins to form a vesicle in the
    M Morales Quiones - 2011 - mospace.umsystem.edu
     
    6. INSTITUTO OSWALDO CRUZ
    MM Villa - 2006 - bdtd.cict.fiocruz.br
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch