.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y8c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a S-adenosylmethionine-dependent methyltransferase from Clostridium acetobutylicum ATCC 824. To be Published
    Site NYSGXRC
    PDB Id 1y8c Target Id NYSGXRC-T1987
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS8259,15895638 Molecular Weight 29874.03 Da.
    Residues 252 Isoelectric Point 4.91
    Sequence mncynkfahiydkliradvdykkwsdfiiekcvennlvfddyldlacgtgnltenlcpkfkntwavdls qemlseaenkfrsqglkprlacqdisnlninrkfdlitccldstnyiidsddlkkyfkavsnhlkeggv fifdinsyyklsqvlgnndfnydddevfyywenqfeddlvsmyisffvrdgefykrfdeeheeraykee diekylkhgqlnildkvdcysnkkvekfteritylvklggksngr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.275
    Matthews' coefficent 3.00 Rfactor 0.221
    Waters 50 Solvent Content 58.64

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1y8c
    1. Molecular phylogenetics and comparative modeling of HEN1, a methyltransferase involved in plant microRNA biogenesis
    K Tkaczuk, A Obarska, J Bujnicki - BMC evolutionary biology, 2006 - biomedcentral.com
     
    2. Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics
    R Shi, SS Lamb, B Zakeri, A Proteau, Q Cui, T Sulea - Chemistry & biology, 2009 - Elsevier
     
    3. Identification of a Missing Sequence and Functionally Important Residues of 16S rRNA: m^ 1A1408 Methyltransferase KamB that Causes Bacterial Resistance to
    L Koscinski, M Feder - CELL CYCLE-LANDES , 2007 - landesbioscience.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch