.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y9e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of hypothetical protein yhfP from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 1y9e Target Id NYSGXRC-T786
    Related PDB Ids 1tt7 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8131,2633368, O07615 Molecular Weight 34754.56 Da.
    Residues 330 Isoelectric Point 4.91
    Sequence mstlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivreyplilgida agtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnlslkeamvygtagftaals vhrleqnglspekgsvlvtgatggvggiavsmlnkrgydvvastgnreaadylkqlgasevisredvyd gtlkalskqqwqgavdpvggkqlasllskiqyggsvavsgltgggevpatvypfilrgvsllgidsvyc pmdvraavwermssdlkpdqlltivdrevsleetpgalkdilqnriqgrvivkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.80 Rfree 0.233
    Matthews' coefficent 2.83 Rfactor 0.227
    Waters 353 Solvent Content 55.00

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 6
    Metals

    Jmol

     
    Google Scholar output for 1y9e
    1. Identifying Horizontal Gene Transfer Using Anomalies In Protein Structures And Sequences
    VRB Santosh - 2011 - digitalcommons.unl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch