.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y9q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of HTH_3 family Transcriptional Regulator from Vibrio cholerae. To be Published
    Site NYSGXRC
    PDB Id 1y9q Target Id NYSGXRC-T1656
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8216,15641970 Molecular Weight 21649.36 Da.
    Residues 192 Isoelectric Point 6.02
    Sequence msltdvmfksqianqlknlrksrglsldataqltgvskamlgqiergessptiatlwkiasgleasfsa ffandpqllssersfpddlnmkihtlfpyaadtgleifeitlldhhqqmssphalgvieyihvlegimk vffdeqwhelqqgehirffsdqphgyaavtekavfqnivayprreggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.224
    Matthews' coefficent 2.10 Rfactor 0.199
    Waters 120 Solvent Content 41.00

    Ligand Information
    Ligands MED (D-METHIONINE) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1y9q
    1. Crystal structure of the restriction-modification system control element C. BclI and mapping of its binding site
    MR Sawaya, Z Zhu, F Mersha, S Chan, R Dabur, S Xu - Structure, 2005 - Elsevier
     
    2. Secondary structure of SsoII-like (Cytosine-5)-DNA methyltransferases N-terminal region determined by Circular dichroism spectroscopy
    AY Ryazanova, NV Molochkov, LA Abrosimova - Molecular Biology, 2010 - Springer
     
    3. Functional analysis of archaeal MBF1 by complementation studies in yeast
    JM Coto, AE Ehrenhofer-Murray, T Pons - Biology direct, 2011 - biology-direct.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch