.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yav

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a hypothetical protein (ykul) containing CBS domains from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 1yav Target Id NYSGXRC-T1655
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8215,16078477 Molecular Weight 17987.89 Da.
    Residues 159 Isoelectric Point 5.83
    Sequence mslislqsdqlleatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmim nsifgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegiftrrvvlk elnkhirslnkeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.262
    Matthews' coefficent 2.10 Rfactor 0.228
    Waters 72 Solvent Content 40.40

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yav
    1. Biochemical and Structural Characterization of a Novel Family of Cystathionine [beta]-Synthase Domain Proteins Fused to a Zn Ribbon-Like Domain
    M Proudfoot, SA Sanders, A Singer, R Zhang - Journal of molecular , 2008 - Elsevier
     
    2. Structure of a CBS-domain pair from the regulatory 1 subunit of human AMPK in complex with AMP and ZMP
    P Day, A Sharff, L Parra, A Cleasby - Section D: Biological , 2007 - scripts.iucr.org
     
    3. Structure of the Bateman2 domain of yeast Snf4: dimeric association and relevance for AMP binding
    MJ Rudolph, GA Amodeo, SH Iram, SP Hong, G Pirino - Structure, 2007 - Elsevier
     
    4. Binding of S-methyl-5'-thioadenosine and S-adenosyl-L-methionine to protein MJ0100 triggers an open-to-closed conformational change in its CBS motif pair
    M Lucas, JA Encinar, EA Arribas, I Oyenarte - Journal of molecular , 2010 - Elsevier
     
    5. Structures and functional implications of an AMP-binding cystathionine _-synthase domain protein from a hyperthermophilic archaeon
    NP King, TM Lee, MR Sawaya, D Cascio - Journal of molecular , 2008 - Elsevier
     
    6. Crystal structure of ST2348, a CBS domain protein, from hyperthermophilic archaeon Sulfolobus tokodaii
    P Ragunathan, T Kumarevel, Y Agari, A Shinkai - Biochemical and , 2008 - Elsevier
     
    7. The structure and unusual protein chemistry of hypoxic response protein 1, a latency antigen and highly expressed member of the DosR regulon in Mycobacterium
    ML Sharpe, C Gao, SL Kendall, EN Baker - Journal of molecular , 2008 - Elsevier
     
    8. The CBS Domain Protein MJ0729 of Methanocaldococcus jannaschii Is a Thermostable Protein with a pH-Dependent Self-Oligomerization
    LA Marti_nez-Cruz, JA Encinar, D Kortazar, J Prieto - Biochemistry, 2009 - ACS Publications
     
    9. Purification, crystallization and preliminary crystallographic analysis of the CBS-domain protein MJ1004 from Methanocaldococcus jannaschii
    I Oyenarte, M Lucas, I Gomez Garcia - Section F: Structural , 2011 - scripts.iucr.org
     
    10. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     
    11. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch