.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ybe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Nicotinate phosphoribosyltransferase. To be Published
    Site NYSGXRC
    PDB Id 1ybe Target Id NYSGXRC-T1764
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8232,15887565 Molecular Weight 51569.21 Da.
    Residues 449 Isoelectric Point 6.30
    Sequence mslgnasmtktdiatrvhnhtwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrlae eidemelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelfkrdgqyelnfh grwmdttlweipalsiinelrsrsamrslgyftldvlyarakakmwekverlrelpglrisdfgtrrrh sflwqrwcvealkegigpaftgtsnvllamdsdleavgtnahelpmvvaalaqtneelaaapyqvlkdw nrlyggnllivlpdafgtaaflrnapewvadwtgfrpdsappieggekiiewwrkmgrdprtkmlifsd gldvdaivdtyrhfegrvrmsfgwgtnltndfagcapktiaslkpisivckvsdangrpavklsdnpqk atgdpaeverylkffgeedhkeqkvlveghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.272
    Matthews' coefficent 2.70 Rfactor 0.222
    Waters 324 Solvent Content 53.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch