The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of AMP nucleosidase from Bacteroides thetaiotaomicron. To be published
    Site NYSGXRC
    PDB Id 1ybf Target Id NYSGXRC-T1840
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS8252,29346298 Molecular Weight 29029.66 Da.
    Residues 258 Isoelectric Point 5.38
    Sequence mktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaegvtlinfgm gsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsndylpeevpslpsfsvlr aissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgvdmetatlmtvgfankipmgalllis drpmfpegvkteesdqlvtdnfaeehlmlgidaleiirenkssikhirfnw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.2641
    Matthews' coefficent 2.70 Rfactor 0.2281
    Waters 16 Solvent Content 54.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch