.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yco

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a branched-chain phosphotransacylase from Enterococcus faecalis V583. To be Published
    Site NYSGXRC
    PDB Id 1yco Target Id NYSGXRC-T1914
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS8256,29376217 Molecular Weight 29596.68 Da.
    Residues 273 Isoelectric Point 6.06
    Sequence mitvsiaggsqpeilqlvkkalkeaeqplqfivfdtnenldtenlwkyvhcsdeaavaqeavslvatgq aqillkgiiqthtllkemlksehqlknkpilshvamvelpagktflltdcamniaptqatlieivenak evaqklglhhpkiallsaaenfnpkmpssvlakevtahfndqqeatvfgplsldlatseeavahkrysg pimgdadilvvptidvgnclyksltlfghakvggtivgtkvpvvltsrsdsteskfhslrfamrqv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.283
    Matthews' coefficent 2.41 Rfactor 0.232
    Waters 172 Solvent Content 48.64

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1yco
    1. Conformational lability in serine protease active sites: structures of hepatocyte growth factor activator (HGFA) alone and with the inhibitory domain from HGFA inhibitor
    S Shia, J Stamos, D Kirchhofer, B Fan, J Wu - Journal of molecular , 2005 - Elsevier
     
    2. Exploring functional roles of multibinding protein interfaces
    M Tyagi, BA Shoemaker, SH Bryant - Protein , 2009 - Wiley Online Library
     
    3. An ion-channel modulator from the saliva of the brown ear tick has a highly modified Kunitz/BPTI structure
    GC Paesen, C Siebold, ML Dallas, C Peers - Journal of molecular , 2009 - Elsevier
     
    4. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch