.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ydf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical protein, hydrolase haloacid dehalogenase-like family. To be Published
    Site NYSGXRC
    PDB Id 1ydf Target Id NYSGXRC-T1724
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS8222,15901261 Molecular Weight 29301.81 Da.
    Residues 266 Isoelectric Point 5.03
    Sequence mslykgylidldgtiykgkdripagetfvhelqkrdipylfvtnnttrtpesvkemlaqnfnidtplst vytatlatidymndlglektvyvvgeaglkeaikaagyvedkekpayvvvgldwqvdyekfatatlaiq kgahfigtnpdlniptergllpgagslitllevatrvkpvyigkpnaiimdkavehlglereelimvgd nyltdiragidngiptllvttgftkaeevaglpiapthvvsslaewdfdeneghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.267
    Matthews' coefficent 2.50 Rfactor 0.217
    Waters 86 Solvent Content 51.00

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1ydf
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. Prediction of transition metal_binding sites from apo protein structures
    M Babor, S Gerzon, B Raveh - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. Structure and activity analyses of Escherichia coli K-12 NagD provide insight into the evolution of biochemical function in the haloalkanoic acid dehalogenase
    LW Tremblay, D Dunaway-Mariano, KN Allen - Biochemistry, 2006 - ACS Publications
     
    4. Characterization and crystal structure of the type IIG restriction endonuclease RM. BpuSI
    BW Shen, D Xu, SH Chan, Y Zheng, Z Zhu - Nucleic acids , 2011 - Oxford Univ Press
     
    5. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch