.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yey

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of L-fuconate Dehydratase from Xanthomonas campestris pv. campestris str. ATCC 33913. To be Published
    Site NYSGXRC
    PDB Id 1yey Target Id NYSGXRC-T2188
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS8277,21233491 Molecular Weight 48402.34 Da.
    Residues 444 Isoelectric Point 5.27
    Sequence gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgndvqtaa vaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaawdlaaraankplwrf iaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatlieqgypayttspgwlgysdeklvr lakeavadgfrtiklkvganvqddirrcrlaraaigpdiamavdanqrwdvgpaidwmrqlaefdiawi eeptspddvlghaairqgitpvpvstgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaa kfgvrvfphaggvglcelvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfs aemhpasiaefsypdgrfwvedlaaskaka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.34 Rfree 0.272
    Matthews' coefficent 2.46 Rfactor 0.247
    Waters 205 Solvent Content 48.09

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 1yey
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. Transient knockdown and overexpression reveal a developmental role for the zebrafish enosf1b gene
    S Finckbeiner, PJ Ko, B Carrington, R Sood - Cell & , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch