.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yga

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Yeast Aldose_1_Epimerase. To be Published
    Site NYSGXRC
    PDB Id 1yga Target Id NYSGXRC-T2077
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8268,6324399 Molecular Weight 37849.79 Da.
    Residues 342 Isoelectric Point 6.26
    Sequence msnsngdnkygvitigdekkfqatiaplgatlvdlkvngqsvvqgysnvqdyltdgnmmgatvgryanr iakgvfslddgphkltvnncgntnhssisslnlkqykaspvenpskgvyvvefkllddhtqpnpnefpg dlevtvkytlnvaemtldmeyqaqlvrgdatpinmtnhsyfnlnkvkseksirgtevkvcsnkslevte gallptgkiierniatfdstkptvlhedtpvfdctfiidankdlkttdsvsvnklvpvfkayhpeshik fevstteptvhlytgdnlcgkfvprsgfavqqgryvdainrdewrgcvllkrgevytsktqykfdi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.229
    Matthews' coefficent 2.38 Rfactor 0.207
    Waters 539 Solvent Content 49.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yga
    1. BALBES: a molecular-replacement pipeline
    F Long, AA Vagin, P Young - Section D: Biological , 2007 - scripts.iucr.org
     
    2. Structure-based Functional Annotation
    M Graille, JP Baltaze, N Leulliot, D Liger - Journal of Biological , 2006 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch