.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yi7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of beta-xylosidase from clostridium acetobutylicum. To be Published
    Site NYSGXRC
    PDB Id 1yi7 Target Id NYSGXRC-T1998
    Related PDB Ids 1y7b 
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS8262,15896693 Molecular Weight 61243.63 Da.
    Residues 533 Isoelectric Point 5.71
    Sequence miknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtslldmkgnpnsg giwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpitlngsgfdaslfhdndgkky lvnmywdqrtynhnfygivlqeysdkekkligkakiiykgtdikytegphiyhigdyyylftaeggtty ehsetvarsknidgpyeidpeyplltswhdprnslqkcghaslvhthtdewylahlvgrplpvgnqpvl eqrgycplgretsiqriewvdnwprvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslr iplteniaslkakkgnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyynte nwstiqvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdginwsk vpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.202
    Matthews' coefficent 2.43 Rfactor 0.142
    Waters 2586 Solvent Content 49.10

    Ligand Information
    Ligands SO4 (SULFATE) x 7;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 4;GOL (GLYCEROL) x 20
    Metals CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 1yi7
    1. Structure-function relationships of a catalytically efficient _-D-xylosidase
    DB Jordan, XL Li, CA Dunlap, TR Whitehead - Applied biochemistry , 2007 - Springer
     
    2. _-D-Xylosidase from Selenomonas ruminantium of glycoside hydrolase family 43
    DB Jordan, XL Li, CA Dunlap, TR Whitehead - Applied Biochemistry , 2007 - Springer
     
    3. Purification, crystallization and preliminary X-ray analysis of a thermostable glycoside hydrolase family 43-xylosidase from Geobacillus thermoleovorans IT-08
    A Rohman, N Van Oosterwijk, S Kralj - Section F: Structural , 2007 - scripts.iucr.org
     
    4. Crystallization and preliminary crystallographic analysis of a family 43 _-d-xylosidase from Geobacillus stearothermophilus T-6
    C Brx, K Niefind, A Ben-David, M Leon - Section F: Structural , 2005 - ncbi.nlm.nih.gov
     
    5. Crystallization and preliminary crystallographic analysis of a family 43-D-xylosidase from Geobacillus stearothermophilus T-6
    C Brux, K Niefind, A Ben-David, M Leon - Section F: Structural , 2005 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch