.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yir

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Nicotinate Phosphoribosyltransferase. To be Published
    Site NYSGXRC
    PDB Id 1yir Target Id NYSGXRC-T1804
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8245,15599572 Molecular Weight 45688.22 Da.
    Residues 398 Isoelectric Point 6.20
    Sequence maesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaireqleylaglais deqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwlhvilfevpllamisevrnra rypaatveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcfvgtsn vhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtdcittdaflrdfdly faklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigth ftcdlpgvepmnivvkmsacnghpvakisdtpgkaqcrdpdfihylkhvfqva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.247
    Matthews' coefficent 3.00 Rfactor 0.213
    Waters 716 Solvent Content 59.00

    Ligand Information
    Ligands SO4 (SULFATE) x 12
    Metals

    Jmol

     
    Google Scholar output for 1yir
    1. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    2. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch