.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yix

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ycfH, tatD homolog from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 1yix Target Id NYSGXRC-T2214
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8279,74311661 Molecular Weight 29807.17 Da.
    Residues 265 Isoelectric Point 5.19
    Sequence mflvdshchldgldyeslhkdvddvlakaaardvkfclavattlpgylhmrdlvgerdnvvfscgvhpl nqndpydvedlrrlaaeegvvalgetgldyyytpetkvrqqesfihhiqigrelnkpvivhtrdaradt lailreekvtdcggvlhcftedretagklldlgfyisfsgivtfrnaeqlrdaaryvpldrllvetdsp ylapvphrgkenqpamvrdvaeymavlkgvaveelaqvttdnfarlfhidasrlqsir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.252
    Matthews' coefficent 2.22 Rfactor 0.198
    Waters 562 Solvent Content 44.30

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 1yix
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. Assessment of CASP7 predictions in the high accuracy template_based modeling category
    RJ Read, G Chavali - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    3. Widespread distribution of cell defense against D-aminoacyl-tRNAs
    S Wydau, G Van der Rest, C Aubard, P Plateau - Journal of Biological , 2009 - ASBMB
     
    4. J Cheng - BMC Structural Biology, 2008 - BioMed Central Ltd
    39
     
    5. Valutazione della predizione della struttura proteica: l'iniziativa CASP
    V Thiella - 2010 - tesi.cab.unipd.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch