.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ymy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-acetylglucosamine-6-phosphate deacetylase from Escherichia Coli. To be Published
    Site NYSGXRC
    PDB Id 1ymy Target Id NYSGXRC-T2187
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS8276,16128653 Molecular Weight 40946.82 Da.
    Residues 382 Isoelectric Point 5.65
    Sequence myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvqlngcggvqfn dtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylakhpnqalglhlegpwlnlv kkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaevisklanagivvsaghsnatlkeakagf ragitfathlynampyitgrepglagaildeadiycgiiadglhvdyanirnakrlkgdklclvtdata paganieqfifagktiyyrnglcvdengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigv ekrlgtlaagkvanltaftpdfkitktivngnevvtq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.243
    Matthews' coefficent 2.31 Rfactor 0.212
    Waters Solvent Content 44.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ymy
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. N-Acetyl-D-glucosamine-6-phosphate deacetylase: substrate activation via a single divalent metal ion
    S Richard, DF Xiang, C Xu, FM Raushel - Biochemistry, 2007 - ACS Publications
     
    3. Structural diversity within the mononuclear and binuclear active sites of N-acetyl-D-glucosamine-6-phosphate deacetylase
    S Richard, S Brown, AA Fedorov, EV Fedorov, C Xu - Biochemistry, 2007 - ACS Publications
     
    4. Structural Analysis of N-acetylglucosamine-6-phosphate Deacetylase Apoenzyme from Escherichia coli
    FM Ferreira, G Mendoza-Hernandez - Journal of molecular , 2006 - Elsevier
     
    5. Crystal structure of monofunctional histidinol phosphate phosphatase from Thermus thermophilus HB8
    R Omi, M Goto, I Miyahara, M Manzoku, A Ebihara - Biochemistry, 2007 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch