.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yr0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens. To be Published
    Site NYSGXRC
    PDB Id 1yr0 Target Id NYSGXRC-T1682
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8219,15888245 Molecular Weight 19598.10 Da.
    Residues 175 Isoelectric Point 6.20
    Sequence mslsvelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaildgkvagy asygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaaieaentasirlhesl gfrvvgrfsevgtkfgrwldltcmelklgeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.23
    Matthews' coefficent 2.18 Rfactor 0.192
    Waters 823 Solvent Content 43.13

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 1yr0
    1. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    2. l-Methionine sulfoximine, but not phosphinothricin, is a substrate for an acetyltransferase (gene PA4866) from Pseudomonas aeruginosa: structural and functional
    AM Davies, R Tata, RL Beavil, BJ Sutton - Biochemistry, 2007 - ACS Publications
     
    3. Evolution of insect arylalkylamine N-acetyltransferases: Structural evidence from the yellow fever mosquito, Aedes aegypti
    Q Han, H Robinson, H Ding - Proceedings of the , 2012 - National Acad Sciences
     
    4. Structure and substrate specificity of acetyltransferase ACIAD1637 from Acinetobacter baylyi ADP1
    AM Davies, R Tata, A Snape, BJ Sutton, PR Brown - Biochimie, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch