.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yrh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide. Protein Sci. 14 3004-3012 2005
    Site NYSGXRC
    PDB Id 1yrh Target Id NYSGXRC-T1617
    Related PDB Ids 1ydg 
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8206,15807878 Molecular Weight 22593.17 Da.
    Residues 211 Isoelectric Point 6.05
    Sequence msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieamkdvp eatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaqnvnggqettlqtl ymtamhwgavltppgytdevifksggnpygasvtangqpllendrasirhqvrrqveltaklleggshh hhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 3.11 Rfree 0.2332
    Matthews' coefficent 2.60 Rfactor 0.1978
    Waters 161 Solvent Content 52.90

    Ligand Information
    Ligands FMN (FLAVIN) x 8
    Metals

    Jmol

     
    Google Scholar output for 1yrh
    1. Kappa-alpha plot derived structural alphabet and BLOSUM-like substitution matrix for rapid search of protein structure database
    CH Tung, JW Huang, JM Yang - Genome biology, 2007 - biomedcentral.com
     
    2. An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution
    O Kirillova, M Chruszcz, IA Shumilin - Section D: Biological , 2007 - scripts.iucr.org
     
    3. Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide
    J Gorman, L Shapiro - Protein science, 2005 - Wiley Online Library
     
    4. Crystal structure of the NADH: quinone oxidoreductase WrbA from Escherichia coli
    SLA Andrade, EV Patridge, JG Ferry - Journal of , 2007 - Am Soc Microbiol
     
    5. Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH_dependent FMN reductase activity
    II Vorontsov, G Minasov, JS Brunzelle - Protein , 2007 - Wiley Online Library
     
    6. Structural organization of WrbA in apo-and holoprotein crystals
    J Wolfova, IK Smatanova, J Brynda, JR Mesters - et Biophysica Acta (BBA , 2009 - Elsevier
     
    7. Why WrbA is weaker than flavodoxin in binding FMN. A molecular modeling study
    HF Ji, L Shen, J Carey, R Grandori - Journal of Molecular , 2006 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch