.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yrz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of xylan beta-1,4-xylosidase from Bacillus Halodurans C-125. To be Published
    Site NYSGXRC
    PDB Id 1yrz Target Id NYSGXRC-T1997
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS8260,15616245 Molecular Weight 60481.70 Da.
    Residues 528 Isoelectric Point 5.53
    Sequence mvnriqnpilpgfhpdpsivrvgddyyiatstfewfpgvrihhsrdlkhwrfvsspltrtsqldmkgnm nsggiwapclsyhdgtfyliytdvkqwhgafkdahnylvtaqniegpwsdpiylnssgfdpslfhdddg rkwlvnmiwdyrkgnhpfagiilqeyseaeqklvgpvkniykgtdiqltegphlykkdgyyyllvaegg teyehaatlarsqsidgpyetdpsyplvtstgqpelalqkaghgslvetqngewylahlcgrplkgkyc tlgretaiqkvnwtedgwlriedggnhplrevtapdlpehpfekepelddfdapqlhhqwntlripadp swcsleerpghlrlrgmesltsvhsqslvarrqqsfhcevetkleyqpesfqhmaglviyydtedhvyl hvtwheekgkclqiiqtkggnydellaspiplaeekavylkgrihretmhlyfkqegeaewqpvgptid vthmsddsakqvrftgtfvgmatqdlsgtkkpadfdyfrykeldq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.224
    Matthews' coefficent 2.72 Rfactor 0.207
    Waters 409 Solvent Content 53.04

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yrz
    1. Structure-function relationships of a catalytically efficient _-D-xylosidase
    DB Jordan, XL Li, CA Dunlap, TR Whitehead - Applied biochemistry , 2007 - Springer
     
    2. Expression in Escherichia coli and characterization of _-xylosidases GH39 and GH-43 from Bacillus halodurans C-125
    I Smaali, C Rmond, MJ O'Donohue - Applied microbiology and , 2006 - Springer
     
    3. Molecular dynamics study of prolyl oligopeptidase with inhibitor in binding cavity
    K Kaszuba, T Rg, JFS Pierre - SAR and QSAR in , 2009 - Taylor & Francis
     
    4. Domain analysis of a modular _-L-arabinofuranosidase with a unique carbohydrate binding strategy from the fiber-degrading bacterium Fibrobacter succinogenes
    S Yoshida, CW Hespen, RL Beverly - Journal of , 2010 - Am Soc Microbiol
     
    5. Purification, crystallization and preliminary X-ray analysis of a thermostable glycoside hydrolase family 43-xylosidase from Geobacillus thermoleovorans IT-08
    A Rohman, N Van Oosterwijk, S Kralj - Section F: Structural , 2007 - scripts.iucr.org
     
    6. Use of umbrella sampling to calculate the entrance/exit pathway for Z-pro-prolinal inhibitor in Prolyl Oligopeptidase
    JF St-Pierre, M Karttunen, N Mousseau - Journal of Chemical , 2011 - ACS Publications
     
    7. Crystallization and preliminary crystallographic analysis of a family 43 _-d-xylosidase from Geobacillus stearothermophilus T-6
    C Brx, K Niefind, A Ben-David, M Leon - Section F: Structural , 2005 - ncbi.nlm.nih.gov
     
    8. Crystallization and preliminary crystallographic analysis of exo--1, 5-L-arabinofuranosidase from Streptomyces avermitilis NBRC14893
    Z Fujimoto, H Ichinose, S Kaneko - Acta Crystallographica Section F: , 2008 - scripts.iucr.org
     
    9. Mechanistic studies of retaining _-glycosidases
    R Zhang - 2010 - circle.ubc.ca
     
    10. Crystallization and preliminary crystallographic analysis of a family 43-D-xylosidase from Geobacillus stearothermophilus T-6
    C Brux, K Niefind, A Ben-David, M Leon - Section F: Structural , 2005 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch