.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ys9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein SPy1043 from Streptococcus pyogenes. To be Published
    Site NYSGXRC
    PDB Id 1ys9 Target Id NYSGXRC-T2098
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS8273,61680815 Molecular Weight 27762.49 Da.
    Residues 254 Isoelectric Point 4.87
    Sequence vpykgylidldgtiyqgknripagerfikrlqergipyllvtnnttrtpemvqsmlanqfhvetsieti ytatmatvdymndmnrgktayvigetglksaiaaagyveelenpayvvvgldsqvtyemlaiatlaiqk galfigtnpdlnipterglmpgagalnalleaatrvkpvfigkpnaiimnkslevlgiqrseavmvgdn yltdimagiqndiatilvttgftrpeevptlpiqpdhvlssldewrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.56 Rfree 0.252
    Matthews' coefficent 3.78 Rfactor 0.226
    Waters Solvent Content 66.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ys9
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. Structure and activity analyses of Escherichia coli K-12 NagD provide insight into the evolution of biochemical function in the haloalkanoic acid dehalogenase
    LW Tremblay, D Dunaway-Mariano, KN Allen - Biochemistry, 2006 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch