.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yv9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical protein, hydrolase haloacid dehalogenase-like family. To be Published
    Site NYSGXRC
    PDB Id 1yv9 Target Id NYSGXRC-T1693
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS8220,29375763 Molecular Weight 29037.53 Da.
    Residues 264 Isoelectric Point 4.87
    Sequence msldyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlanefdihvpas lvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvvgldtelsyekvvlatlai qkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvyigkpkaiimeraiahlgvekeqvimvg dnyetdiqsgiqngidsllvtsgftpksavptlptpptyvvdsldewtfeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.28
    Matthews' coefficent 3.50 Rfactor 0.219
    Waters 172 Solvent Content 65.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1yv9
    1. Structure and activity analyses of Escherichia coli K-12 NagD provide insight into the evolution of biochemical function in the haloalkanoic acid dehalogenase
    LW Tremblay, D Dunaway-Mariano, KN Allen - Biochemistry, 2006 - ACS Publications
     
    2. Sulfate acts as phosphate analog on the monomeric catalytic fragment of the CPx-ATPase CopB from Sulfolobus solfataricus
    M Lbben, J Gldenhaupt, M Zoltner - Journal of molecular , 2007 - Elsevier
     
    3. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch