.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yw1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure Of Ytnj From Bacillus Subtilis in complex with FMN. To be Published
    Site NYSGXRC
    PDB Id 1yw1 Target Id NYSGXRC-T773
    Related PDB Ids 1tvl 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8125,O34974, 2635396 Molecular Weight 49408.75 Da.
    Residues 442 Isoelectric Point 5.76
    Sequence mtradfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfiseksiph flnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggragwnlvtspqegaarnhs ksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffdqaklhrlnhkgkyfqvegplnigrs kqgepvvfqagssetgrqfaaknadaifthsnsleetkafyadvksraadegrdpssvrifpgispiva dteeeaekkyrefaelipienavtylarffddydlsvypldepfpdigdvgknafqsttdrikreakar nltlrevaqemafprtlfigtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyr qdyrggtlrenlglgipqhqsvlhsshh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.81 Rfree 0.25241
    Matthews' coefficent 3.70 Rfactor 0.18221
    Waters 69 Solvent Content 66.00

    Ligand Information
    Ligands GLC (ALPHA-D-GLUCOSE) x 1;FMN (FLAVIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yw1
    1. Crystallization and initial crystallographic characterization of the Corynebacterium glutamicum nitrilotriacetate monooxygenase component A
    KJ Kim, S Kim, S Lee, BS Kang, HS Lee - Section F: Structural , 2006 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch