.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ywk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from Enterococcus faecalis V583. To be Published
    Site NYSGXRC
    PDB Id 1ywk Target Id NYSGXRC-T1814
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS8248,29375058 Molecular Weight 32116.81 Da.
    Residues 279 Isoelectric Point 5.13
    Sequence mqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteeleiildkelg vdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenpdnpakfyiscvpahhky pnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmgytilepgsawntmpchtherrmeayv yfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgvgtsnysfiwamcgenitytdmdmvamdqlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.95 Rfree 0.265
    Matthews' coefficent 2.08 Rfactor 0.241
    Waters Solvent Content 38.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ywk
    1. Detection of protein assemblies in crystals
    E Krissinel, K Henrick - Computational Life Sciences, 2005 - Springer
     
    2. Structure-based phylogeny as a diagnostic for functional characterization of proteins with a cupin fold
    G Agarwal, M Rajavel, B Gopal, N Srinivasan - PloS one, 2009 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch