.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z2l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a ternary complex of allantoate amidohydrolase from Escherichia coli reveals its mechanics. J.Mol.Biol. 368 450-463 2007
    Site NYSGXRC
    PDB Id 1z2l Target Id NYSGXRC-3055c
    Related PDB Ids 2imo 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS9400,NP_415049.1, PF01546 Molecular Weight 45560.43 Da.
    Residues 410 Isoelectric Point 5.24
    Sequence ithfrqaieetlpwlssfgadpaggmtrllyspewletqqqfkkrmaasgletrfdevgnlygrlngte ypqevvlsgshidtvvnggnldgqfgalaawlaidwlktqygaplrtvevvamaeeegsrfpyvfwgsk nifglanpddvrnicdakgnsfvdamkacgftlpnapltprqdikafvelhieqgcvlesngqsigvvn aivgqrrytvtlngesnhagttpmgyrrdtvyafsrichqsvekakrmgdplvltfgkveprpntvnvv pgkttftidcrhtdaavlrdftqqlendmraicdemdigididlwmdeepvpmnkelvatltelcerek lnyrvmhsgaghdaqifaprvptcmifipsingishnpaertnitdlaegvktlalmlyqlawqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.273
    Matthews' coefficent 2.36 Rfactor 0.229
    Waters 194 Solvent Content 47.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2;1AL (ALLANTOATE) x 1
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 1z2l
    1. Inference of macromolecular assemblies from crystalline state
    E Krissinel, K Henrick - Journal of molecular biology, 2007 - Elsevier
     
    2. Structural Analysis of a Ternary Complex of Allantoate Amidohydrolase from Escherichia coli Reveals its Mechanics
    R Agarwal, SK Burley, S Swaminathan - Journal of molecular biology, 2007 - Elsevier
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Crystallization and preliminary crystallographic studies of the recombinant lN-carbamoylase from Geobacillus stearothermophilus CECT43
    S Martnez-Rodrguez, A Garca-Pino - Section F: Structural , 2008 - scripts.iucr.org
     
    5. RENNSH: A Novel alpha-Helix Identification Approach for Intermediate Resolution Electron Density Maps
    L Ma, M Reisert, H Burkhardt - IEEE/ACM Transactions on Computational , 2012 - dl.acm.org
     
    6. Structural insight into mechanism and diverse substrate selection strategy of L_ribulokinase
    R Agarwal, SK Burley - : Structure, Function, and , 2012 - Wiley Online Library
     
    7. Mutational and structural analysis of LN-carbamoylase: new insights into a peptidase M20/M25/M40 family member.
    S Martnez-Rodrguez, A Garca-Pino - Journal of , 2012 - Am Soc Microbiol
     
    8. Structural and Functional Analyses Reveal That Staphylococcus aureus Antibiotic Resistance Factor HmrA Is a Zinc-dependent Endopeptidase
    TO Botelho, T Guevara, A Marrero, P Arde - Journal of Biological , 2011 - ASBMB
     
    9. _-alanine synthase: one reaction, two folds and mechanisms
    S Lundgren - 2007 - diss.kib.ki.se
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch