.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z3a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase. Biochemistry 45 6407-6416 2006
    Site NYSGXRC
    PDB Id 1z3a Target Id NYSGXRC-T717
    Molecular Characteristics
    Source Escherichia coli.
    Alias Ids TPS8114,P30134 Molecular Weight 20025.09 Da.
    Residues 178 Isoelectric Point 8.54
    Sequence mrrafitgvfflsevefsheywmrhaltlakrawderevpvgavlvhnnrvigegwnrpigrhdptaha eimalrqgglvmqnyrlidatlyvtlepcvmcagamihsrigrvvfgardaktgaagslmdvlhhpgmn hrveitegiladecaallsdffrmrrqeikaqkkaqsstd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.03 Rfree 0.216
    Matthews' coefficent 2.50 Rfactor 0.176
    Waters 226 Solvent Content 51.20

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1z3a
    1. Transition State Structure of E. coli t RNA-Specific Adenosine Deaminase
    M Luo, VL Schramm - Journal of the American Chemical Society, 2008 - ACS Publications
     
    2. Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase
    J Kim, V Malashkevich, S Roday, M Lisbin - Biochemistry, 2006 - ACS Publications
     
    3. Aminohydrolases acting on adenine, adenosine and their derivatives
    H Pospisilova, I Frebort - BIOMEDICAL PAPERS-PALACKY , 2007 - biomed.papers.upol.cz
     
    4. Crystal structure of the tRNA_specific adenosine deaminase from Streptococcus pyogenes
    WH Lee, YK Kim, KH Nam, A Priyadarshi - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch