.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z4e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transcriptional regulator from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 1z4e Target Id NYSGXRC-T2017
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS8263,15614531 Molecular Weight 17528.26 Da.
    Residues 153 Isoelectric Point 8.47
    Sequence lnihvtireategdleqmvhmladdvlgrkreryekplpvsyvrafkeikkdknnelivacngeeivgm lqvtftpyltyqgswratiegvrthsaargqgigsqlvcwaierakergchliqlttdkqrpdalrfye qlgfkasheglkmhf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 2.25 Rfactor 0.225
    Waters 146 Solvent Content 43.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1z4e
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch