.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z9d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative uridylate kinase (UMP-kinase) from Streptococcus pyogenes. To be Published
    Site NYSGXRC
    PDB Id 1z9d Target Id NYSGXRC-T1668
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS8218,15674581 Molecular Weight 27103.44 Da.
    Residues 252 Isoelectric Point 5.62
    Sequence mslepkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgepaadagm drvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrhleknrivvfgagigs pyfstdttaalraaeieadailmakngvdgvynadpkkdanavkfdelthgevikrglkimdatastls mdndidlvvfnmneagniqrvvfgehigttvsnkvcdeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.80 Rfree 0.247
    Matthews' coefficent 2.68 Rfactor 0.215
    Waters 88 Solvent Content 53.72

    Ligand Information
    Ligands SO4 (SULFATE) x 9
    Metals

    Jmol

     
    Google Scholar output for 1z9d
    1. Structural and enzymatic investigation of the Sulfolobus solfataricus uridylate kinase shows competitive UTP inhibition and the lack of GTP stimulation
    KS Jensen, E Johansson, KF Jensen - Biochemistry, 2007 - ACS Publications
     
    2. The Crystal Structure of UMP Kinase from Bacillus anthracis(BA1797) Reveals an Allosteric Nucleotide-Binding Site
    C Meier, LG Carter, S Sainsbury, EJ Mancini - Journal of molecular , 2008 - Elsevier
     
    3. Unique GTP-binding pocket and allostery of uridylate kinase from a gram-negative phytopathogenic bacterium
    JL Tu, KH Chin, AHJ Wang, SH Chou - Journal of molecular biology, 2009 - Elsevier
     
    4. Structural and functional characterization of the Mycobacterium tuberculosis uridine monophosphate kinase: insights into the allosteric regulation
    G Labesse, K Benkali, I Salard-Arnaud - Nucleic acids , 2011 - Oxford Univ Press
     
    5. Cloning, Expression, Purification and Characterization of UMP Kinase from Staphylococcus aureus
    O Hari Prasad, Y Nanda Kumar, OVS Reddy - The Protein , 2012 - Springer
     
    6. Structural and functional studies of enzymes in nucleotide metabolism
    L Egeblad - 2011 - pub.epsilon.slu.se
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch