.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zcc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glycerophosphodiester phosphodiesterase from Agrobacterium tumefaciens by SAD with a large asymmetric unit. Proteins 65 514-518 2006
    Site NYSGXRC
    PDB Id 1zcc Target Id NYSGXRC-T2047
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8265,17937901 Molecular Weight 27293.42 Da.
    Residues 248 Isoelectric Point 5.25
    Sequence vtkivshrganrfapentfaaadlalqqgadyieldvresadgvlyvihdetldrttngtgpvghmlss eidtldaggwfddrfkgaivprldaylehlrgragvyielkycdpakvaalvrhlgmvrdtfyfsfsee mrqglqsiapefrrmmtldiakspslvgavhhasiieitpaqmrrpgiieasrkagleimvyyggddma vhreiatsdvdyinldrpdlfaavrsgmaelllasnssstc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.50 Rfree 0.281
    Matthews' coefficent 2.93 Rfactor 0.244
    Waters 276 Solvent Content 59.00

    Ligand Information
    Ligands ACT (ACETATE) x 6;SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 1zcc
    1. Crystal structure of glycerophosphodiester phosphodiesterase from Agrobacterium tumefaciens by SAD with a large asymmetric unit
    KN Rao, JB Bonanno, SK Burley - Proteins: Structure, , 2006 - Wiley Online Library
     
    2. Genomic organization, characterization, and molecular 3D model of GDE1, a novel mammalian glycerophosphoinositol phosphodiesterase
    AS Bachmann, FF Duennebier, G Mocz - Gene, 2006 - Elsevier
     
    3. Crystal structure of glycerophosphodiester phosphodiesterase (GDPD) from Thermoanaerobacter tengcongensis, a metal ion_dependent enzyme: Insight into the
    L Shi, JF Liu, XM An, DC Liang - Proteins: Structure, Function, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch