.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zzm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YJJV, TATD homolog from Escherichia coli K12, at 1.8 A resolution. To be Published
    Site NYSGXRC
    PDB Id 1zzm Target Id NYSGXRC-T2215
    Molecular Characteristics
    Source Escherichia coli [k12]
    Alias Ids TPS8280,1176481 Molecular Weight 28907.54 Da.
    Residues 259 Isoelectric Point 6.14
    Sequence micrfidthchfdfppfsgdeeaslqraaqagvgkiivpateaenfarvlalaenyqplyaalglhpgm lekhsdvsleqlqqalerrpakvvavgeigldlfgddpqferqqwlldeqlklakrydlpvilhsrrth dklamhlkrhdlprtgvvhgfsgslqqaerfvqlgykigvggtityprasktrdviaklplasllletd apdmplngfqgqpnrpeqaarvfavlcelrrepadeiaqallnntytlfnvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.231
    Matthews' coefficent 2.10 Rfactor 0.171
    Waters 376 Solvent Content 40.60

    Ligand Information
    Ligands P33 (3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL) x 1
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 1zzm
    1. Evaluation of features for catalytic residue prediction in novel folds
    E Youn, B Peters, P Radivojac, SD Mooney - Protein science, 2007 - Wiley Online Library
     
    2. Crystal structure of monofunctional histidinol phosphate phosphatase from Thermus thermophilus HB8
    R Omi, M Goto, I Miyahara, M Manzoku, A Ebihara - Biochemistry, 2007 - ACS Publications
     
    3. Widespread distribution of cell defense against D-aminoacyl-tRNAs
    S Wydau, G Van der Rest, C Aubard, P Plateau - Journal of Biological , 2009 - ASBMB
     
    4. Investigating diproline segments in proteins: Occurrences, conformation and classification
    I Saha, N Shamala - Biopolymers, 2012 - Wiley Online Library
     
    5. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    6. Cartographie structurale et fonctionnelle de la liaison entre la peptidyl-ARNt hydrolase et son substrat
    G Laurent - 2010 - hal-polytechnique.archives-ouvertes
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch