.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a1v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein from Deinococcus radiodurans. To be Published
    Site NYSGXRC
    PDB Id 2a1v Target Id NYSGXRC-T1777
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8239,15807390 Molecular Weight 16276.65 Da.
    Residues 144 Isoelectric Point 6.03
    Sequence mslqtpmqtvddlrsvcdelphsletfpfddetlvfkvgylsksrmyaltditqdplrlslkvdperge elrqahpqsiapgyhlnkkhwvtvtldgtvpaellgellrgsyllvtkkgftkaerkelglpdsleggs hhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.22544
    Matthews' coefficent 2.20 Rfactor 0.161
    Waters 111 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a1v
    1. NMR structure of protein yjbR from Escherichia coli reveals 'double_wing'DNA binding motif
    KK Singarapu, G Liu, R Xiao, C Bertonati - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Solution NMR and X-ray crystal structures of Pseudomonas syringae Pspto_3016 from protein domain family PF04237 (DUF419) adopt a double wing DNA binding
    EA Feldmann, J Seetharaman, TA Ramelot - Journal of structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch