.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a9f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)). To be Published
    Site NYSGXRC
    PDB Id 2a9f Target Id NYSGXRC-T1727
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS8223,15675092 Molecular Weight 42078.16 Da.
    Residues 398 Isoelectric Point 5.86
    Sequence mslknqlgqlaleqaktfggklevqpkvdiktkhdlsiaytpgvasvssaiakdktlaydlttkkntva visdgtavlglgdigpeaampvmegkaalfkafagvdaipivldtkdteeiisivkalaptfgginled isaprcfeieqrlikechipvfhddqhgtaivvlaaifnslkllkksldevsivvngggsaglsitrkl laagatkvtvvdkfgiineqeaaqlaphhldiakvtnrefksgtledalegadifigvsapgvlkaewi skmaarpvifamanpipeiypdealeagayivgtgrsdfpnqinnvlafpgifrgaldaraktitvemq iaaakgiaslvpddalsttniipdafkegvaeivaksvrsvvlkseghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.3044
    Matthews' coefficent 43.90 Rfactor 0.2604
    Waters 49 Solvent Content 2.20

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2a9f
    1. Structural insights into cold inactivation of tryptophanase and cold adaptation of subtilisin S41
    O Almog, A Kogan, M Leeuw, GY Gdalevsky - , 2008 - Wiley Online Library
     
    2. Informative Motifs in Protein Family Alignments
    H Ozer, W Ray - Algorithms in Bioinformatics, 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch