.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aa4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia Coli Putative N-Acetylmannosamine Kinase. To be Published
    Site NYSGXRC
    PDB Id 2aa4 Target Id NYSGXRC-T806
    Molecular Characteristics
    Source Escherichia coli.
    Alias Ids TPS8139,P45425 Molecular Weight 29642.07 Da.
    Residues 291 Isoelectric Point 5.63
    Sequence mttlaidiggtklaaaligadgqirdrrelptpasqtpealrdalsalvsplqahaqrvaiastgiird gsllalnphnlggllhfplvktleqltnlptiaindaqaaawaefqaldgditdmvfitvstgvgggvv sgcklltgpgglaghightladphgpvcgcgrtgcveaiasgrgiaaaaqgelagadaktiftragqgd eqaqqlihrsartlarliadikattdcqcvvvggsvglaegylalvetylaqepaafhvdllaahyrhd agllgaallaqgekl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.24298
    Matthews' coefficent 2.10 Rfactor 0.17852
    Waters 238 Solvent Content 40.97

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2aa4
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Influence of UDP-GlcNAc 2-epimerase/ManNAc kinase mutant proteins on hereditary inclusion body myopathy
    J Penner, LR Mantey, S Elgavish, D Ghaderi - Biochemistry, 2006 - ACS Publications
     
    4. Crystal structure of the N-acetylmannosamine kinase domain of GNE
    Y Tong, W Tempel, L Nedyalkova, F MacKenzie - PloS one, 2009 - dx.plos.org
     
    5. Divergent evolution of function in the ROK sugar kinase superfamily: role of enzyme loops in substrate specificity
    M Larion, LB Moore, SM Thompson, BG Miller - Biochemistry, 2007 - ACS Publications
     
    6. Molecular modeling of the bifunctional enzyme UDP-GlcNAc 2-epimerase/ManNAc kinase and predictions of structural effects of mutations associated with HIBM and
    N Kurochkina, T Yardeni, M Huizing - Glycobiology, 2010 - Soc Glycobiology
     
    7. Evolutionary bases of carbohydrate recognition and substrate discrimination in the ROK protein family
    MS Conejo, SM Thompson, BG Miller - Journal of molecular evolution, 2010 - Springer
     
    8. Structural Studies of ROK Fructokinase YdhR from Bacillus subtilis: Insights into Substrate Binding and Fructose Specificity
    B Nocek, AJ Stein, R Jedrzejczak, ME Cuff, H Li - Journal of Molecular , 2011 - Elsevier
     
    9. Substrate recognition mechanism and substrate-dependent conformational changes of an ROK family glucokinase from Streptomyces griseus
    K Miyazono, N Tabei, S Morita, Y Ohnishi - Journal of , 2012 - Am Soc Microbiol
     
    10. Purification, crystallization and preliminary X-ray analysis of glucokinase from Streptomyces griseus in complex with glucose
    K Miyazono, N Tabei, K Marushima - Section F: Structural , 2011 - scripts.iucr.org
     
    11. COLLEGE OF ARTS AND SCIENCES
    M Larion - 2009 - diginole.lib.fsu.edu
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch